PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA13G00104
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 189aa    MW: 22136.4 Da    PI: 10.6088
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA13G00104genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.7e-1074131663
                 HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 r +r+ +NRe+A+rsR +K++ +ee +++  +L+ eNk+L+++      ++++ k+e+
  AA13G00104  74 RNKRRLSNRESAKRSRMKKLKHMEEMKNRLNQLKIENKELANRFRYVVYHYQQTKTEN 131
                 789**************************************99887777777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.2E-867116No hitNo description
SMARTSM003387.2E-869133IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9171134IPR004827Basic-leucine zipper domain
PfamPF001702.3E-874131IPR004827Basic-leucine zipper domain
CDDcd147023.01E-1574118No hitNo description
SuperFamilySSF579593.38E-874125No hitNo description
PROSITE patternPS0003607691IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MMSTISPVIS SETGLLTSIP SFETKYFTPY QISDLFSTLN SSVNPKPVQD YVKPGSVTKH  60
LNRTGLDNNS NELRNKRRLS NRESAKRSRM KKLKHMEEMK NRLNQLKIEN KELANRFRYV  120
VYHYQQTKTE NDRLRLEHRI LQDKLFTIRG LLMFHQIERS SICATWPYIN STVVTVHQNP  180
SLVTNHVIV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002877702.12e-69bZIP transcription factor family protein
TrEMBLD7LSY02e-69D7LSY0_ARALL; BZIP transcription factor family protein
STRINGscaffold_501993.16e-69(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33382665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49760.15e-58basic leucine-zipper 5